Class a: All alpha proteins [46456] (289 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) |
Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins) |
Protein EnvZ histidine kinase [47386] (1 species) |
Species Escherichia coli [TaxId:562] [47387] (1 PDB entry) |
Domain d1joya_: 1joy A: [16991] |
PDB Entry: 1joy (more details)
SCOPe Domain Sequences for d1joya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} maagvkqladdrtllmagvshdlrtpltrirlatemmseqdgylaesinkdieecnaiie qfidylr
Timeline for d1joya_: