Lineage for d1joya_ (1joy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995434Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1995474Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 1995475Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins)
  6. 1995476Protein EnvZ histidine kinase [47386] (1 species)
  7. 1995477Species Escherichia coli [TaxId:562] [47387] (1 PDB entry)
  8. 1995478Domain d1joya_: 1joy A: [16991]

Details for d1joya_

PDB Entry: 1joy (more details)

PDB Description: solution structure of the homodimeric domain of envz from escherichia coli by multi-dimensional nmr.
PDB Compounds: (A:) protein (envz_ecoli)

SCOPe Domain Sequences for d1joya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]}
maagvkqladdrtllmagvshdlrtpltrirlatemmseqdgylaesinkdieecnaiie
qfidylr

SCOPe Domain Coordinates for d1joya_:

Click to download the PDB-style file with coordinates for d1joya_.
(The format of our PDB-style files is described here.)

Timeline for d1joya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1joyb_