![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.1: ROP protein [47380] (1 family) ![]() automatically mapped to Pfam PF01815 |
![]() | Family a.30.1.1: ROP protein [47381] (1 protein) |
![]() | Protein ROP protein [47382] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47383] (18 PDB entries) Uniprot P03051 |
![]() | Domain d1f4ma_: 1f4m A: [16983] a multiple mutant with a repacked hydrophobic core and a new dimerization mode complexed with ca |
PDB Entry: 1f4m (more details), 2.25 Å
SCOPe Domain Sequences for d1f4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4ma_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]} gtkqektilnmarfirsqaltilekaneldadeiadiaesihdhadeiyrsalarf
Timeline for d1f4ma_: