| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) ![]() |
| Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
| Protein automated matches [190369] (3 species) not a true protein |
| Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (3 PDB entries) |
| Domain d2x2dd_: 2x2d D: [169823] Other proteins in same PDB: d2x2db_, d2x2dc_ automated match to d1afva_ |
PDB Entry: 2x2d (more details), 1.9 Å
SCOPe Domain Sequences for d2x2dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x2dd_ a.73.1.1 (D:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys
Timeline for d2x2dd_: