SCOPe 2.04: Domain d2x25b_: 2x25 B:

Lineage for d2x25b_ (2x25 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (14 PDB entries)

8. Domain d2x25b_: 2x25 B: [169817]
   automated match to d1ak4a_

Details for d2x25b_

PDB Entry: 2x25, 1.2 Å

PDB Description: free acetyl-cypa orthorhombic form

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d2x25b_:

Sequence; same for both SEQRES and ATOM records:

>d2x25b_ b.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhhhhvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhri
ipgfmcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffict
aktkwldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgql

Timeline for d2x25b_:

• d2x25b_ first appeared in SCOPe 2.01
  
• d2x25b_ appears in SCOPe 2.03
  
• d2x25b_ appears in SCOPe 2.05
  
• d2x25b_ appears in the current release, SCOPe 2.08, called d2x25b1