Lineage for d2wxbb_ (2wxb B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385579Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1385580Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1385599Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 1385618Protein automated matches [190527] (4 species)
    not a true protein
  7. 1385619Species Escherichia coli [TaxId:469008] [189333] (2 PDB entries)
  8. 1385623Domain d2wxbb_: 2wxb B: [169682]
    automated match to d1gs5a_
    complexed with act, dtu, edo

Details for d2wxbb_

PDB Entry: 2wxb (more details), 2 Å

PDB Description: acetylglutamate kinase from escherichia coli free of substrates
PDB Compounds: (B:) acetylglutamate kinase

SCOPe Domain Sequences for d2wxbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wxbb_ c.73.1.2 (B:) automated matches {Escherichia coli [TaxId: 469008]}
mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk
kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg
hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills
dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha
eqlpalfngmpmgtrila

SCOPe Domain Coordinates for d2wxbb_:

Click to download the PDB-style file with coordinates for d2wxbb_.
(The format of our PDB-style files is described here.)

Timeline for d2wxbb_: