Lineage for d1gs5a_ (1gs5 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385579Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1385580Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1385599Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 1385600Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 1385601Species Escherichia coli [TaxId:562] [75299] (5 PDB entries)
  8. 1385602Domain d1gs5a_: 1gs5 A: [70395]
    complexed with anp, mg, nlg

Details for d1gs5a_

PDB Entry: 1gs5 (more details), 1.5 Å

PDB Description: N-acetyl-L-glutamate kinase from Escherichia coli complexed with its substrate N-acetylglutamate and its substrate analog AMPPNP
PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d1gs5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]}
mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk
kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg
hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills
dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha
eqlpalfngmpmgtrila

SCOPe Domain Coordinates for d1gs5a_:

Click to download the PDB-style file with coordinates for d1gs5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gs5a_: