Lineage for d2wv6f_ (2wv6 F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398385Species Citrobacter freundii [TaxId:546] [189098] (1 PDB entry)
  8. 2398388Domain d2wv6f_: 2wv6 F: [169659]
    automated match to d3efxd1
    complexed with edo, gol

Details for d2wv6f_

PDB Entry: 2wv6 (more details), 1.89 Å

PDB Description: crystal structure of the cholera toxin-like b-subunit from citrobacter freundii to 1.9 angstrom
PDB Compounds: (F:) cfxb

SCOPe Domain Sequences for d2wv6f_:

Sequence, based on SEQRES records: (download)

>d2wv6f_ b.40.2.1 (F:) automated matches {Citrobacter freundii [TaxId: 546]}
apqnitelcseyhntqiyelnkeiktyteslagyremviisfangatfqvevpgsqhles
qkrplermkdtlraayftgikvsklcvwnnktpnsiaaielsn

Sequence, based on observed residues (ATOM records): (download)

>d2wv6f_ b.40.2.1 (F:) automated matches {Citrobacter freundii [TaxId: 546]}
apqnitelcseyhntqiyelnkeiktyteslamviisfangatfqvelesqkrplermkd
tlraayftgikvsklcvwnnktpnsiaaielsn

SCOPe Domain Coordinates for d2wv6f_:

Click to download the PDB-style file with coordinates for d2wv6f_.
(The format of our PDB-style files is described here.)

Timeline for d2wv6f_: