Lineage for d2wtvc_ (2wtv C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589707Protein automated matches [190091] (20 species)
    not a true protein
  7. 2589831Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)
  8. 2590309Domain d2wtvc_: 2wtv C: [169622]
    automated match to d1ol5a_
    complexed with act, dms, edo, zzl

Details for d2wtvc_

PDB Entry: 2wtv (more details), 2.4 Å

PDB Description: aurora-a inhibitor structure
PDB Compounds: (C:) serine/threonine-protein kinase 6 aurora/ipl1-related kinase 1, breast tumor-amplified kinase, aurora-a, aurora-related kinase 1, hark1

SCOPe Domain Sequences for d2wtvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtvc_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanssk

SCOPe Domain Coordinates for d2wtvc_:

Click to download the PDB-style file with coordinates for d2wtvc_.
(The format of our PDB-style files is described here.)

Timeline for d2wtvc_: