SCOPe 2.01: Domain d1ffha1: 1ffh A:2-88

Lineage for d1ffha1 (1ffh A:2-88)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)

8. Domain d1ffha1: 1ffh A:2-88 [16960]
   Other proteins in same PDB: d1ffha2
   complexed with mg

Details for d1ffha1

PDB Entry: 1ffh, 2.05 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

PDB Compounds: (A:) ffh

SCOPe Domain Sequences for d1ffha1:

Sequence; same for both SEQRES and ATOM records:

>d1ffha1 a.24.13.1 (A:2-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
fqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreealg
kqvlesltpaevilatvyealkealgg

Timeline for d1ffha1:

• d1ffha1 first appeared (with stable ids) in SCOP 1.55, called d1ffh_1
  
• d1ffha1 appears in SCOP 1.75
  
• d1ffha1 appears in SCOPe 2.02
  
• d1ffha1 appears in the current release, SCOPe 2.08