Lineage for d2wqae_ (2wqa E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132927Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1132928Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1132929Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1133227Protein Retinol binding protein [50816] (5 species)
  7. 1133247Species Human (Homo sapiens) [TaxId:9606] [50819] (7 PDB entries)
  8. 1133253Domain d2wqae_: 2wqa E: [169562]
    Other proteins in same PDB: d2wqaa_, d2wqab_, d2wqac_, d2wqad_
    automated match to d1brpa_
    complexed with ola, so4

Details for d2wqae_

PDB Entry: 2wqa (more details), 2.85 Å

PDB Description: complex of ttr and rbp4 and oleic acid
PDB Compounds: (E:) retinol-binding protein 4

SCOPe Domain Sequences for d2wqae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqae_ b.60.1.1 (E:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdg

SCOPe Domain Coordinates for d2wqae_:

Click to download the PDB-style file with coordinates for d2wqae_.
(The format of our PDB-style files is described here.)

Timeline for d2wqae_: