| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Type I TGF-beta receptor R4 [56144] (1 species) TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases |
| Species Human (Homo sapiens) [TaxId:9606] [56145] (32 PDB entries) Uniprot P36897 200-500 ! Uniprot P36897 201-503 |
| Domain d2woua1: 2wou A:200-496 [169533] Other proteins in same PDB: d2woua2 automated match to d1vjya_ complexed with edo, zzf |
PDB Entry: 2wou (more details), 2.3 Å
SCOPe Domain Sequences for d2woua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2woua1 d.144.1.7 (A:200-496) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqls
Timeline for d2woua1: