| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein Macrophage elastase (MMP-12) [69780] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries) Uniprot P39900 106-263 ! Uniprot P39900 106-264 |
| Domain d2wo8c_: 2wo8 C: [169512] Other proteins in same PDB: d2wo8a2 automated match to d1os2a_ complexed with 023, 077, ca, gol, so4, zn |
PDB Entry: 2wo8 (more details), 2 Å
SCOPe Domain Sequences for d2wo8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wo8c_ d.92.1.11 (C:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslygdpke
Timeline for d2wo8c_:
View in 3DDomains from other chains: (mouse over for more information) d2wo8a1, d2wo8a2, d2wo8b_, d2wo8d_ |