Lineage for d2wo2b_ (2wo2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772145Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF00812
  6. 2772167Protein automated matches [190316] (1 species)
    not a true protein
  7. 2772168Species Human (Homo sapiens) [TaxId:9606] [187131] (6 PDB entries)
  8. 2772172Domain d2wo2b_: 2wo2 B: [169501]
    Other proteins in same PDB: d2wo2a1, d2wo2a2, d2wo2a3
    automated match to d1ikop_
    complexed with nag

Details for d2wo2b_

PDB Entry: 2wo2 (more details), 2.45 Å

PDB Description: crystal structure of the epha4-ephrinb2 complex
PDB Compounds: (B:) ephrin-b2

SCOPe Domain Sequences for d2wo2b_:

Sequence, based on SEQRES records: (download)

>d2wo2b_ b.6.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvgqd

Sequence, based on observed residues (ATOM records): (download)

>d2wo2b_ b.6.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdgqyeyykvymvdkdqadrcti
kkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqegg
vcqtramkilmkvgqd

SCOPe Domain Coordinates for d2wo2b_:

Click to download the PDB-style file with coordinates for d2wo2b_.
(The format of our PDB-style files is described here.)

Timeline for d2wo2b_: