![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein automated matches [190095] (19 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [189174] (6 PDB entries) |
![]() | Domain d2wnnb_: 2wnn B: [169478] automated match to d1hl2a_ complexed with 1pe, na |
PDB Entry: 2wnn (more details), 1.65 Å
SCOPe Domain Sequences for d2wnnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnnb_ c.1.10.1 (B:) automated matches {Escherichia coli [TaxId: 562]} atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh pdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer
Timeline for d2wnnb_: