Lineage for d2wmob_ (2wmo B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1163707Protein CDC42 [52619] (2 species)
  7. 1163708Species Human (Homo sapiens) [TaxId:9606] [52620] (27 PDB entries)
  8. 1163723Domain d2wmob_: 2wmo B: [169456]
    automated match to d1doaa_
    complexed with gtp, mg

Details for d2wmob_

PDB Entry: 2wmo (more details), 2.2 Å

PDB Description: structure of the complex between dock9 and cdc42.
PDB Compounds: (B:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d2wmob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wmob_ c.37.1.8 (B:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
hmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdta
gqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidl
rddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal

SCOPe Domain Coordinates for d2wmob_:

Click to download the PDB-style file with coordinates for d2wmob_.
(The format of our PDB-style files is described here.)

Timeline for d2wmob_: