Lineage for d2wmcb_ (2wmc B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211433Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 1211434Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 1211470Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 1211471Protein automated matches [190708] (5 species)
    not a true protein
  7. 1211478Species Pea (Pisum sativum) [TaxId:3888] [189457] (1 PDB entry)
  8. 1211480Domain d2wmcb_: 2wmc B: [169448]
    automated match to d2v8we1
    complexed with mgp

Details for d2wmcb_

PDB Entry: 2wmc (more details), 2.2 Å

PDB Description: crystal structure of eukaryotic initiation factor 4e from pisum sativum
PDB Compounds: (B:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d2wmcb_:

Sequence, based on SEQRES records: (download)

>d2wmcb_ d.86.1.0 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
phllenswtfwfdtpaakskqaawgssmrpiytfstveefwsiynnihhpgklavgadfy
cfkhkiepkwedpicanggkwtanypkgksdtswlytllamigeqfdhgdeicgavvnvr
graekisiwtknasneaaqvsigkqwkefldynetmgfifhddarkldrnaknkyvv

Sequence, based on observed residues (ATOM records): (download)

>d2wmcb_ d.86.1.0 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
phllenswtfwfdtawgssmrpiytfstveefwsiynnihhadfycfkhkiepkwedpic
anggkwtanypkgksdtswlytllamigeqfdhgdeicgavvnvrgraekisiwtknasn
eaaqvsigkqwkefldynetmgfifhddarknaknkyvv

SCOPe Domain Coordinates for d2wmcb_:

Click to download the PDB-style file with coordinates for d2wmcb_.
(The format of our PDB-style files is described here.)

Timeline for d2wmcb_: