Lineage for d2wlpa_ (2wlp A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2076096Family b.121.4.7: Tombusviridae-like VP [88643] (5 protein domains)
  6. 2076135Protein automated matches [190821] (1 species)
    not a true protein
  7. 2076136Species SMV (Sesbania mosaic virus) [TaxId:12558] [188106] (4 PDB entries)
  8. 2076138Domain d2wlpa_: 2wlp A: [169433]
    automated match to d1vaka_
    mutant

Details for d2wlpa_

PDB Entry: 2wlp (more details), 2.65 Å

PDB Description: sesbania mosaic virus capsid protein dimer mutant (rcp-del-n65-w170k)
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d2wlpa_:

Sequence, based on SEQRES records: (download)

>d2wlpa_ b.121.4.7 (A:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvksgsaglcfingtrcsdtstais
ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
tytiqmieptas

Sequence, based on observed residues (ATOM records): (download)

>d2wlpa_ b.121.4.7 (A:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsta
gsihmgfqydmadtvpvsvnqlsnlrgyvsgqvksgsaglcfingtrsdtstaisttldv
sklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyctytiq
mieptas

SCOPe Domain Coordinates for d2wlpa_:

Click to download the PDB-style file with coordinates for d2wlpa_.
(The format of our PDB-style files is described here.)

Timeline for d2wlpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2wlpb_