Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.15: A novel bacterial esterase [53552] (2 proteins) |
Protein automated matches [191062] (1 species) not a true protein |
Species Alcaligenes sp. [TaxId:512] [188954] (1 PDB entry) |
Domain d2wkwa_: 2wkw A: [169421] automated match to d1qlwa_ complexed with gol, so4, w22 |
PDB Entry: 2wkw (more details), 2.03 Å
SCOPe Domain Sequences for d2wkwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkwa_ c.69.1.15 (A:) automated matches {Alcaligenes sp. [TaxId: 512]} tpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqrakrypitl ihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainavklgkapa sslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsmptpnptv anlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedvkpltsip vlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmmmqdrnnl qvadlildwigrnta
Timeline for d2wkwa_: