SCOPe 2.01: Domain d2wkwa_: 2wkw A:

Lineage for d2wkwa_ (2wkw A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.15: A novel bacterial esterase [53552] (2 proteins)

6. Protein automated matches [191062] (1 species)
   not a true protein

7. Species Alcaligenes sp. [TaxId:512] [188954] (1 PDB entry)

8. Domain d2wkwa_: 2wkw A: [169421]
   automated match to d1qlwa_
   complexed with gol, so4, w22

Details for d2wkwa_

PDB Entry: 2wkw, 2.03 Å

PDB Description: alcaligenes esterase complexed with product analogue

PDB Compounds: (A:) carboxylesterase

SCOPe Domain Sequences for d2wkwa_:

Sequence; same for both SEQRES and ATOM records:

>d2wkwa_ c.69.1.15 (A:) automated matches {Alcaligenes sp. [TaxId: 512]}
tpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqrakrypitl
ihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainavklgkapa
sslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsmptpnptv
anlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedvkpltsip
vlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmmmqdrnnl
qvadlildwigrnta

Timeline for d2wkwa_:

• d2wkwa_ is new in SCOPe 2.01-stable
  
• d2wkwa_ appears in SCOPe 2.02
  
• d2wkwa_ appears in the current release, SCOPe 2.08