SCOPe 2.07: Domain d2wkse_: 2wks E:

Lineage for d2wkse_ (2wks E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
   automatically mapped to Pfam PF01220

6. Protein automated matches [190071] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [187015] (7 PDB entries)

8. Domain d2wkse_: 2wks E: [169419]
   automated match to d1j2ya_
   complexed with cb6

Details for d2wkse_

PDB Entry: 2wks, 2.95 Å

PDB Description: structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor.

PDB Compounds: (E:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2wkse_:

Sequence; same for both SEQRES and ATOM records:

>d2wkse_ c.23.13.1 (E:) automated matches {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqe

Timeline for d2wkse_:

• d2wkse_ first appeared in SCOPe 2.01
  
• d2wkse_ appears in SCOPe 2.06
  
• d2wkse_ appears in the current release, SCOPe 2.08