SCOPe 2.04: Domain d2wk0b_: 2wk0 B:

Lineage for d2wk0b_ (2wk0 B:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [188244] (9 PDB entries)

8. Domain d2wk0b_: 2wk0 B: [169393]
   automated match to d1i2wb_
   complexed with biy, cit, cl, eoh, so4

Details for d2wk0b_

PDB Entry: 2wk0, 1.65 Å

PDB Description: crystal structure of the class a beta-lactamase bs3 inhibited by 6-beta-iodopenicillanate.

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d2wk0b_:

Sequence; same for both SEQRES and ATOM records:

>d2wk0b_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvvkaln

Timeline for d2wk0b_:

• d2wk0b_ first appeared in SCOPe 2.01
  
• d2wk0b_ appears in SCOPe 2.03
  
• d2wk0b_ appears in SCOPe 2.05
  
• d2wk0b_ appears in the current release, SCOPe 2.08