| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
| Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein automated matches [190161] (29 species) not a true protein |
| Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries) |
| Domain d2wk0a_: 2wk0 A: [169392] automated match to d1i2wb_ complexed with biy, cit, cl, eoh, so4 |
PDB Entry: 2wk0 (more details), 1.65 Å
SCOPe Domain Sequences for d2wk0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wk0a_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvvkaln
Timeline for d2wk0a_: