SCOPe 2.08: Domain d2wg3a1: 2wg3 A:40-194

Lineage for d2wg3a1 (2wg3 A:40-194)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
   automatically mapped to Pfam PF01085

6. Protein automated matches [190324] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188953] (17 PDB entries)

8. Domain d2wg3a1: 2wg3 A:40-194 [169324]
   Other proteins in same PDB: d2wg3a2, d2wg3a3
   automated match to d1vhha_
   complexed with cl, nag, po4, zn

Details for d2wg3a1

PDB Entry: 2wg3, 2.6 Å

PDB Description: crystal structure of the complex between human hedgehog-interacting protein hip and desert hedgehog without calcium

PDB Compounds: (A:) desert hedgehog protein n-product

SCOPe Domain Sequences for d2wg3a1:

Sequence, based on SEQRES records:

>d2wg3a1 d.65.1.2 (A:40-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrlm
terckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnky
gllarlaveagfdwvyyesrnhvhvsvkadnslav

Sequence, based on observed residues (ATOM records):

>d2wg3a1 d.65.1.2 (A:40-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkgadrlmterck
ervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnkygllar
laveagfdwvyyesrnhvhvsvkadnslav

Timeline for d2wg3a1:

• d2wg3a1 first appeared in SCOPe 2.01, called d2wg3a_
  
• d2wg3a1 appears in SCOPe 2.07