SCOPe 2.07: Domain d2wfcd1: 2wfc D:29-186

Lineage for d2wfcd1 (2wfc D:29-186)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (20 species)
   not a true protein

7. Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries)

8. Domain d2wfcd1: 2wfc D:29-186 [169304]
   Other proteins in same PDB: d2wfca2, d2wfcb2, d2wfcc2, d2wfcd2
   automated match to d1urma_
   complexed with act

Details for d2wfcd1

PDB Entry: 2wfc, 1.75 Å

PDB Description: crystal structure of peroxiredoxin 5 from arenicola marina

PDB Compounds: (D:) peroxiredoxin 5

SCOPe Domain Sequences for d2wfcd1:

Sequence; same for both SEQRES and ATOM records:

>d2wfcd1 c.47.1.10 (D:29-186) automated matches {Arenicola marina [TaxId: 6344]}
pikegdklpavtvfgatpndkvnmaelfagkkgvlfavpgaftpgsskthlpgyveqaaa
ihgkgvdiiacmavndsfvmdawgkahgaddkvqmladpggaftkavdmeldlsavlgnv
rskryslviedgvvtkvnvepdgkgltcslapnilsql

Timeline for d2wfcd1:

• d2wfcd1 first appeared in SCOPe 2.01, called d2wfcd_
  
• d2wfcd1 appears in SCOPe 2.06
  
• d2wfcd1 appears in the current release, SCOPe 2.08