Lineage for d2wefa_ (2wef A:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1233851Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1233852Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1233853Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1234035Protein automated matches [190281] (4 species)
    not a true protein
  7. 1234039Species Human (Homo sapiens) [TaxId:9606] [187709] (12 PDB entries)
  8. 1234040Domain d2wefa_: 2wef A: [169272]
    automated match to d1jp4a_
    complexed with amp, mg, po4

Details for d2wefa_

PDB Entry: 2wef (more details), 1.8 Å

PDB Description: human 3'(2'), 5'-bisphosphate nucleotidase 1 (bpnt1) in complex with amp, po4 and magnesium
PDB Compounds: (A:) 3'(2'), 5'-bisphosphate nucleotidase 1

SCOPe Domain Sequences for d2wefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wefa_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlmrlvasaysiaqkagmivrrviaegdlgivektcatdlqtkadrlaqmsicsslark
fpkltiigeedlpseevdqeliedsqweeilkqpcpsqysaikeedlvvwvdpldgtkey
teglldnvtvligiayegkaiagvinqpyynyeagpdavlgrtiwgvlglgafgfqlkev
pagkhiitttrshsnklvtdcvaamnpdavlrvggagnkiiqliegkasayvfaspgckk
wdtcapevilhavggkltdihgnvlqyhkdvkhmnsagvlatlrnydyyasrvpesikna
lvp

SCOPe Domain Coordinates for d2wefa_:

Click to download the PDB-style file with coordinates for d2wefa_.
(The format of our PDB-style files is described here.)

Timeline for d2wefa_: