SCOP 1.75: Domain d1higb_: 1hig B:

Lineage for d1higb_ (1hig B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Human (Homo sapiens) [TaxId:9606] [47320] (5 PDB entries)

8. Domain d1higb_: 1hig B: [16918]
   CA-atoms only

Details for d1higb_

PDB Entry: 1hig, 3.5 Å

PDB Description: three-dimensional structure of recombinant human interferon-gamma.

PDB Compounds: (B:) interferon-gamma

SCOP Domain Sequences for d1higb_:

Sequence; same for both SEQRES and ATOM records:

>d1higb_ a.26.1.3 (B:) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
qdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfknf
kddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmael
spa

Timeline for d1higb_:

• d1higb_ first appeared (with stable ids) in SCOP 1.55
  
• d1higb_ appears in SCOP 1.73
  
• d1higb_ appears in SCOPe 2.01
  
• d1higb_ appears in the current release, SCOPe 2.08