Lineage for d2w79a_ (2w79 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1566370Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1566403Protein automated matches [190186] (7 species)
    not a true protein
  7. 1566425Species Thermotoga maritima [TaxId:2336] [186925] (4 PDB entries)
  8. 1566428Domain d2w79a_: 2w79 A: [169091]
    automated match to d1qo2a_
    complexed with cl

Details for d2w79a_

PDB Entry: 2w79 (more details), 1.85 Å

PDB Description: establishing wild-type levels of catalytic activity on natural and artificial (ba)8-barrel protein scaffolds
PDB Compounds: (A:) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d2w79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w79a_ c.1.2.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
mlvvpaidlfrgkvarmikgrkentifyekdpvelveklieegftlihvvdlsnaiensg
enlpvleklsefaeyiqigggirsldyaeklrklgyrrqivsskvledpsslkslreidv
epvfslvtrggrvafkgwlaeeeidpvsllkrlkeygleeivhteiekvgtlqehdfslt
kkiaieaevkvlaaggissenslktaqkvhtetngllkgvivgraflegiltvevmkrya
r

SCOPe Domain Coordinates for d2w79a_:

Click to download the PDB-style file with coordinates for d2w79a_.
(The format of our PDB-style files is described here.)

Timeline for d2w79a_: