SCOP 1.71: Domain d1rfbb_: 1rfb B:

Lineage for d1rfbb_ (1rfb B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Cow (Bos taurus) [TaxId:9913] [47319] (3 PDB entries)

8. Domain d1rfbb_: 1rfb B: [16906]

Details for d1rfbb_

PDB Entry: 1rfb, 3 Å

PDB Description: crystal structure of recombinant bovine interferon-gamma at 3.0 angstroms resolution

SCOP Domain Sequences for d1rfbb_:

Sequence; same for both SEQRES and ATOM records:

>d1rfbb_ a.26.1.3 (B:) Interferon-gamma {Cow (Bos taurus)}
qgqffreienlkeyfnasspdvakggplfseilknwkdesdkkiiqsqivsfyfklfenl
kdnqviqrsmdiikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmnd

Timeline for d1rfbb_:

• d1rfbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1rfbb_ appears in SCOP 1.69
  
• d1rfbb_ appears in SCOP 1.73
  
• d1rfbb_ appears in the current release, SCOPe 2.08