| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins) contains an additional helix in one of the crossover connections |
| Protein Interferon-gamma [47318] (3 species) intertwined dimer |
| Species Cow (Bos taurus) [TaxId:9913] [47319] (3 PDB entries) |
| Domain d1rfba_: 1rfb A: [16905] |
PDB Entry: 1rfb (more details), 3 Å
SCOP Domain Sequences for d1rfba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfba_ a.26.1.3 (A:) Interferon-gamma {Cow (Bos taurus)}
qgqffreienlkeyfnasspdvakggplfseilknwkdesdkkiiqsqivsfyfklfenl
kdnqviqrsmdiikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmnd
Timeline for d1rfba_: