Lineage for d1rfba_ (1rfb A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins) 
Protein Interferon-gamma [47318] (3 species) Species Cow (Bos taurus) [TaxId:9913] [47319] (3 PDB entries) 
Domain d1rfba_: 1rfb A: [16905]
Details for d1rfba_
PDB Entry: 1rfb (more details), 3 Å
PDB Description: crystal structure of recombinant bovine interferon-gamma at 3.0 angstroms resolution
SCOP Domain Sequences for d1rfba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rfba_ a.26.1.3 (A:) Interferon-gamma {Cow (Bos taurus)}
qgqffreienlkeyfnasspdvakggplfseilknwkdesdkkiiqsqivsfyfklfenl
kdnqviqrsmdiikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmnd
SCOP Domain Coordinates for d1rfba_:
Click to download the PDB-style file with coordinates for d1rfba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rfba_:
- d1rfba_ appears in SCOP 1.57
- d1rfba_ appears in the current release, SCOPe 2.08
View in 3D
