Lineage for d2w11b_ (2w11 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884220Species Sulfolobus tokodaii [TaxId:111955] [188720] (2 PDB entries)
  8. 1884224Domain d2w11b_: 2w11 B: [168995]
    automated match to d1juda_
    complexed with 2op

Details for d2w11b_

PDB Entry: 2w11 (more details), 1.9 Å

PDB Description: structure of the l-2-haloacid dehalogenase from sulfolobus tokodaii
PDB Compounds: (B:) 2-haloalkanoic acid dehalogenase

SCOPe Domain Sequences for d2w11b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w11b_ c.108.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
gshmiilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvr
geeskfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkg
ifsaesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivd
piggkpdvivndfkelyewilryk

SCOPe Domain Coordinates for d2w11b_:

Click to download the PDB-style file with coordinates for d2w11b_.
(The format of our PDB-style files is described here.)

Timeline for d2w11b_: