Lineage for d1juda_ (1jud A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883151Family c.108.1.1: HAD-related [56785] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 1883155Protein L-2-Haloacid dehalogenase, HAD [56786] (2 species)
  7. 1883156Species Pseudomonas sp., strain YL [TaxId:306] [56787] (4 PDB entries)
  8. 1883159Domain d1juda_: 1jud A: [43325]

Details for d1juda_

PDB Entry: 1jud (more details), 2.5 Å

PDB Description: l-2-haloacid dehalogenase
PDB Compounds: (A:) l-2-haloacid dehalogenase

SCOPe Domain Sequences for d1juda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1juda_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}
yikgiafdlygtlfdvhsvvgrcdeafpgrgreisalwrqkqleytwlrslmnryvnfqq
atedalrftcrhlgldldartrstlcdaylrlapfsevpdslrelkrrglklailsngsp
qsidavvshaglrdgfdhllsvdpvqvykpdnrvyelaeqalgldrsailfvssnawdat
garyfgfptcwinrtgnvfeemgqtpdwevtslravvelf

SCOPe Domain Coordinates for d1juda_:

Click to download the PDB-style file with coordinates for d1juda_.
(The format of our PDB-style files is described here.)

Timeline for d1juda_: