SCOPe 2.07: Domain d2w0xa_: 2w0x A:

Lineage for d2w0xa_ (2w0x A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)

6. Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82196] (34 PDB entries)

8. Domain d2w0xa_: 2w0x A: [168991]
   automated match to d1iz3a_
   complexed with fe2, gol, pd2, so4

Details for d2w0xa_

PDB Entry: 2w0x, 2.12 Å

PDB Description: factor inhibiting hif-1 alpha with pyridine 2,4 dicarboxylic acid

PDB Compounds: (A:) hypoxia-inducible factor 1 alpha inhibitor

SCOPe Domain Sequences for d2w0xa_:

Sequence; same for both SEQRES and ATOM records:

>d2w0xa_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
avasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdt
nlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhe
fveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnll
ligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnp
dyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrie
yplkahqkvaimrniekmlgealgnpqevgpllntmikgryn

Timeline for d2w0xa_:

• d2w0xa_ first appeared in SCOPe 2.01
  
• d2w0xa_ appears in SCOPe 2.06
  
• d2w0xa_ appears in the current release, SCOPe 2.08