Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein automated matches [190182] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186920] (30 PDB entries) |
Domain d2w0dd_: 2w0d D: [168980] automated match to d1jk3a_ complexed with act, ca, cgs, cl, na, zn |
PDB Entry: 2w0d (more details), 2 Å
SCOPe Domain Sequences for d2w0dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w0dd_ d.92.1.11 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighsl glghssdpkavmfptykyvdintfrlsaddirgiqslygh
Timeline for d2w0dd_: