Lineage for d2w0dd_ (2w0d D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1423977Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1424301Protein automated matches [190182] (1 species)
    not a true protein
  7. 1424302Species Human (Homo sapiens) [TaxId:9606] [186920] (30 PDB entries)
  8. 1424332Domain d2w0dd_: 2w0d D: [168980]
    automated match to d1jk3a_
    complexed with act, ca, cgs, cl, na, zn

Details for d2w0dd_

PDB Entry: 2w0d (more details), 2 Å

PDB Description: does a fast nuclear magnetic resonance spectroscopy- and x-ray crystallography hybrid approach provide reliable structural information of ligand-protein complexes? a case study of metalloproteinases.
PDB Compounds: (D:) Macrophage metalloelastase

SCOPe Domain Sequences for d2w0dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0dd_ d.92.1.11 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslygh

SCOPe Domain Coordinates for d2w0dd_:

Click to download the PDB-style file with coordinates for d2w0dd_.
(The format of our PDB-style files is described here.)

Timeline for d2w0dd_: