Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) |
Protein Serum amyloid P component (SAP) [49952] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49953] (9 PDB entries) |
Domain d2w08a_: 2w08 A: [168969] automated match to d1gyka_ complexed with ca, nag, tpo |
PDB Entry: 2w08 (more details), 1.7 Å
SCOPe Domain Sequences for d2w08a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w08a_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa nildwqalnyeirgyviikplvwv
Timeline for d2w08a_:
View in 3D Domains from other chains: (mouse over for more information) d2w08b_, d2w08c_, d2w08d_, d2w08e_ |