Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Dendronephthya sp. [TaxId:191210] [188919] (1 PDB entry) |
Domain d2vzxe_: 2vzx E: [168963] automated match to d1mova_ complexed with gol, pg4 |
PDB Entry: 2vzx (more details), 2 Å
SCOPe Domain Sequences for d2vzxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzxe_ d.22.1.1 (E:) automated matches {Dendronephthya sp. [TaxId: 191210]} likedmrvkvhmegnvnghafviegegkgkpyegtqtanltvkegaplpfsydilttavh ygnrvftkypedipdyfkqsfpegyswertmtfedkgictirsdislegdcffqnvrfkg tnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkv vqlpdahfvdhrieilgndsdynkvklyehavarysplpsqvwhh
Timeline for d2vzxe_: