Lineage for d2vxif_ (2vxi F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1484638Protein Bacterioferritin (cytochrome b1) [47244] (5 species)
    binds heme between two subunits; 24-mer
  7. 1484717Species Escherichia coli [TaxId:562] [47245] (11 PDB entries)
  8. 1484735Domain d2vxif_: 2vxi F: [168910]
    automated match to d1bcfa_
    complexed with hem, so4, zn

Details for d2vxif_

PDB Entry: 2vxi (more details), 1.91 Å

PDB Description: the binding of heme and zinc in escherichia coli bacterioferritin
PDB Compounds: (F:) bacterioferritin

SCOPe Domain Sequences for d2vxif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxif_ a.25.1.1 (F:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqiree

SCOPe Domain Coordinates for d2vxif_:

Click to download the PDB-style file with coordinates for d2vxif_.
(The format of our PDB-style files is described here.)

Timeline for d2vxif_: