Lineage for d2vxab_ (2vxa B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008035Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 3008137Family d.230.2.0: automated matches [191578] (1 protein)
    not a true family
  6. 3008138Protein automated matches [191015] (5 species)
    not a true protein
  7. 3008139Species Halorhodospira halophila [TaxId:1053] [188782] (1 PDB entry)
  8. 3008141Domain d2vxab_: 2vxa B: [168894]
    automated match to d2ux9a1
    complexed with cl, rbf

Details for d2vxab_

PDB Entry: 2vxa (more details), 2.6 Å

PDB Description: h. halophila dodecin in complex with riboflavin
PDB Compounds: (B:) dodecin

SCOPe Domain Sequences for d2vxab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxab_ d.230.2.0 (B:) automated matches {Halorhodospira halophila [TaxId: 1053]}
dhvykiveltgsspngieeavnnaiaragetlrhlrwfevvdtrghieggrvnhwqvtvk
vgftleg

SCOPe Domain Coordinates for d2vxab_:

Click to download the PDB-style file with coordinates for d2vxab_.
(The format of our PDB-style files is described here.)

Timeline for d2vxab_: