Lineage for d2ux9a1 (2ux9 A:2-67)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008035Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 3008036Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
    automatically mapped to Pfam PF07311
  6. 3008041Protein Uncharacterized protein TTHA1431 [159869] (1 species)
  7. 3008042Species Thermus thermophilus [TaxId:274] [159870] (3 PDB entries)
    Uniprot Q5SIE3 2-67! Uniprot Q5SIE3 2-68
  8. 3008044Domain d2ux9a1: 2ux9 A:2-67 [152258]
    Other proteins in same PDB: d2ux9b_, d2ux9c_, d2ux9d_, d2ux9e_, d2ux9f_
    complexed with coa, fmn, na, po4; mutant

Details for d2ux9a1

PDB Entry: 2ux9 (more details), 1.4 Å

PDB Description: crystal structure of the t. thermophilus dodecin r65a mutant
PDB Compounds: (A:) dodecin

SCOPe Domain Sequences for d2ux9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux9a1 d.230.2.1 (A:2-67) Uncharacterized protein TTHA1431 {Thermus thermophilus [TaxId: 274]}
gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
vgfale

SCOPe Domain Coordinates for d2ux9a1:

Click to download the PDB-style file with coordinates for d2ux9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ux9a1: