Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name automatically mapped to Pfam PF07311 |
Protein Uncharacterized protein TTHA1431 [159869] (1 species) |
Species Thermus thermophilus [TaxId:274] [159870] (3 PDB entries) Uniprot Q5SIE3 2-67! Uniprot Q5SIE3 2-68 |
Domain d2ux9a1: 2ux9 A:2-67 [152258] Other proteins in same PDB: d2ux9b_, d2ux9c_, d2ux9d_, d2ux9e_, d2ux9f_ complexed with coa, fmn, na, po4; mutant |
PDB Entry: 2ux9 (more details), 1.4 Å
SCOPe Domain Sequences for d2ux9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ux9a1 d.230.2.1 (A:2-67) Uncharacterized protein TTHA1431 {Thermus thermophilus [TaxId: 274]} gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle vgfale
Timeline for d2ux9a1: