Lineage for d2vspc_ (2vsp C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948106Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 948107Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 948564Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 948565Protein automated matches [190436] (3 species)
    not a true protein
  7. 948566Species Human (Homo sapiens) [TaxId:9606] [187333] (15 PDB entries)
  8. 948591Domain d2vspc_: 2vsp C: [168793]
    automated match to d1i92a_

Details for d2vspc_

PDB Entry: 2vsp (more details), 2.6 Å

PDB Description: crystal structure of the fourth pdz domain of pdz domain-containing protein 1
PDB Compounds: (C:) pdz domain-containing protein 1

SCOPe Domain Sequences for d2vspc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vspc_ b.36.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkpklcrlakgengygfhlnairglpgsfikevqkggpadlaglededviievngvnvld
epyekvvdriqssgknvtllvcg

SCOPe Domain Coordinates for d2vspc_:

Click to download the PDB-style file with coordinates for d2vspc_.
(The format of our PDB-style files is described here.)

Timeline for d2vspc_: