Lineage for d2vs6b_ (2vs6 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606087Protein automated matches [190420] (9 species)
    not a true protein
  7. 2606249Species Mongolian snake-gourd (Trichosanthes kirilowii) [TaxId:3677] [187299] (2 PDB entries)
  8. 2606253Domain d2vs6b_: 2vs6 B: [168785]
    automated match to d1gisa_

Details for d2vs6b_

PDB Entry: 2vs6 (more details), 2.4 Å

PDB Description: k173a, r174a, k177a-trichosanthin
PDB Compounds: (B:) ribosome-inactivating protein alpha-trichosanthin

SCOPe Domain Sequences for d2vs6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vs6b_ d.165.1.1 (B:) automated matches {Mongolian snake-gourd (Trichosanthes kirilowii) [TaxId: 3677]}
mdvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadet
isvaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaag
kireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigaavdatf
lpslaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsnial
llnrnnma

SCOPe Domain Coordinates for d2vs6b_:

Click to download the PDB-style file with coordinates for d2vs6b_.
(The format of our PDB-style files is described here.)

Timeline for d2vs6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vs6a_