SCOPe 2.07: Domain d2vs4b_: 2vs4 B:

Lineage for d2vs4b_ (2vs4 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
   automatically mapped to Pfam PF03414

6. Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries)
   Uniprot P14769

8. Domain d2vs4b_: 2vs4 B: [168783]
   automated match to d1g8oa_
   complexed with gol, mn, nlc, udp; mutant

Details for d2vs4b_

PDB Entry: 2vs4, 1.77 Å

PDB Description: the binding of udp-galactose by an active site mutant of alpha-1,3 galactosyltransferase (alpha3gt)

PDB Compounds: (B:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d2vs4b_:

Sequence; same for both SEQRES and ATOM records:

>d2vs4b_ c.68.1.9 (B:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
sklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryi
ehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdism
mrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndfty
errkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwheeshl
nkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv

Timeline for d2vs4b_:

• d2vs4b_ first appeared in SCOPe 2.01
  
• d2vs4b_ appears in SCOPe 2.06
  
• d2vs4b_ appears in the current release, SCOPe 2.08