SCOPe 2.08: Domain d2vpka1: 2vpk A:4-116

Lineage for d2vpka1 (2vpk A:4-116)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d2vpka1: 2vpk A:4-116 [168760]
   Other proteins in same PDB: d2vpka2
   automated match to d1r28a_

Details for d2vpka1

PDB Entry: 2vpk, 2 Å

PDB Description: crystal structure of the btb domain of human myoneurin

PDB Compounds: (A:) myoneurin

SCOPe Domain Sequences for d2vpka1:

Sequence; same for both SEQRES and ATOM records:

>d2vpka1 d.42.1.0 (A:4-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shhcehllerlnkqreagflcdctivigefqfkahrnvlasfseyfgaiyrstsennvfl
dqsqvkadgfqkllefiytgtlnldswnvkeihqaadylkveevvtkckikme

Timeline for d2vpka1:

• d2vpka1 first appeared in SCOPe 2.01, called d2vpka_
  
• d2vpka1 appears in SCOPe 2.07