Class b: All beta proteins [48724] (174 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.11: Kelch motif [117281] (2 families) |
Family b.68.11.0: automated matches [191536] (1 protein) not a true family |
Protein automated matches [190912] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188385] (2 PDB entries) |
Domain d2vpja_: 2vpj A: [168759] automated match to d1x2ja1 complexed with act |
PDB Entry: 2vpj (more details), 1.85 Å
SCOPe Domain Sequences for d2vpja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vpja_ b.68.11.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} anevllvvggfgsqqspidvvekydpktqewsflpsitrkrryvasvslhdriyviggyd grsrlssvecldytadedgvwysvapmnvrrglagattlgdmiyvsggfdgsrrhtsmer ydpnidqwsmlgdmqtaregaglvvasgviyclggydglnilnsvekydphtghwtnvtp matkrsgagvallndhiyvvggfdgtahlssveaynirtdswttvtsmttprcyvgatvl rgrlyaiagydgnsllssiecydpiidswevvtsmgtqrcdagvcvlre
Timeline for d2vpja_: