Lineage for d2vpja_ (2vpj A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134683Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1135244Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 1135262Family b.68.11.0: automated matches [191536] (1 protein)
    not a true family
  6. 1135263Protein automated matches [190912] (1 species)
    not a true protein
  7. 1135264Species Human (Homo sapiens) [TaxId:9606] [188385] (2 PDB entries)
  8. 1135265Domain d2vpja_: 2vpj A: [168759]
    automated match to d1x2ja1
    complexed with act

Details for d2vpja_

PDB Entry: 2vpj (more details), 1.85 Å

PDB Description: crystal structure of the kelch domain of human klhl12
PDB Compounds: (A:) kelch-like protein 12

SCOPe Domain Sequences for d2vpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpja_ b.68.11.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anevllvvggfgsqqspidvvekydpktqewsflpsitrkrryvasvslhdriyviggyd
grsrlssvecldytadedgvwysvapmnvrrglagattlgdmiyvsggfdgsrrhtsmer
ydpnidqwsmlgdmqtaregaglvvasgviyclggydglnilnsvekydphtghwtnvtp
matkrsgagvallndhiyvvggfdgtahlssveaynirtdswttvtsmttprcyvgatvl
rgrlyaiagydgnsllssiecydpiidswevvtsmgtqrcdagvcvlre

SCOPe Domain Coordinates for d2vpja_:

Click to download the PDB-style file with coordinates for d2vpja_.
(The format of our PDB-style files is described here.)

Timeline for d2vpja_: