Lineage for d2vmli_ (2vml I:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 903785Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 903940Protein automated matches [190531] (6 species)
    not a true protein
  7. 903944Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)
  8. 903957Domain d2vmli_: 2vml I: [168710]
    automated match to d1i7ya_
    complexed with cyc

Details for d2vmli_

PDB Entry: 2vml (more details), 2.4 Å

PDB Description: the monoclinic structure of phycocyanin from gloeobacter violaceus
PDB Compounds: (I:) phycocyanin alpha chain

SCOPe Domain Sequences for d2vmli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vmli_ a.1.1.3 (I:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
nlspswyiealkhikgkvgsqlsgqplteanayidycinals

SCOPe Domain Coordinates for d2vmli_:

Click to download the PDB-style file with coordinates for d2vmli_.
(The format of our PDB-style files is described here.)

Timeline for d2vmli_: