Lineage for d2vlva_ (2vlv A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602740Species Hordeum vulgare [TaxId:112509] [188423] (3 PDB entries)
  8. 1602743Domain d2vlva_: 2vlv A: [168691]
    automated match to d1xfla_

Details for d2vlva_

PDB Entry: 2vlv (more details), 1.7 Å

PDB Description: crystal structure of barley thioredoxin h isoform 2 in partially radiation-reduced state
PDB Compounds: (A:) thioredoxin h isoform 2.

SCOPe Domain Sequences for d2vlva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlva_ c.47.1.0 (A:) automated matches {Hordeum vulgare [TaxId: 112509]}
aevisvhsleqwtmqieeantakklvvidftaswcgpcrimapvfadlakkfpnavflkv
dvdelkpiaeqfsveamptflfmkegdvkdrvvgaikeeltakvglhaaaq

SCOPe Domain Coordinates for d2vlva_:

Click to download the PDB-style file with coordinates for d2vlva_.
(The format of our PDB-style files is described here.)

Timeline for d2vlva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vlvb_