SCOP 1.69: Domain d1etea_: 1ete A:

Lineage for d1etea_ (1ete A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (11 proteins)

6. Protein Flt3 ligand [47297] (1 species)
   forms dimer similar to the M-CSF and SCF dimers

7. Species Human (Homo sapiens) [TaxId:9606] [47298] (1 PDB entry)

8. Domain d1etea_: 1ete A: [16869]

Details for d1etea_

PDB Entry: 1ete, 2.2 Å

PDB Description: crystal structure of the flt3 ligand

SCOP Domain Sequences for d1etea_:

Sequence; same for both SEQRES and ATOM records:

>d1etea_ a.26.1.2 (A:) Flt3 ligand {Human (Homo sapiens)}
tqdcsfqhspissdfavkirelsdyllqdypvtvasnlqddelcgglwrlvlaqrwmerl
ktvagskmqgllervnteihfvtkcafqpppsclrfvqtnisrllqetseqlvalkpwit
rqnfsrclelqcqp

Timeline for d1etea_:

• d1etea_ first appeared (with stable ids) in SCOP 1.55
  
• d1etea_ appears in SCOP 1.67
  
• d1etea_ appears in SCOP 1.71
  
• d1etea_ appears in the current release, SCOPe 2.08