![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein automated matches [190100] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187259] (20 PDB entries) |
![]() | Domain d2vl9a_: 2vl9 A: [168679] automated match to d1oc3a_ |
PDB Entry: 2vl9 (more details), 2.7 Å
SCOPe Domain Sequences for d2vl9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl9a_ c.47.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae alkakgvqvvaslsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql
Timeline for d2vl9a_: