Lineage for d2vjqc_ (2vjq C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1630609Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 1630610Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (1 family) (S)
  5. 1630611Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 1630679Protein automated matches [190402] (3 species)
    not a true protein
  7. 1630686Species Oxalobacter formigenes [TaxId:847] [187276] (7 PDB entries)
  8. 1630689Domain d2vjqc_: 2vjq C: [168657]
    automated match to d1p5ha_
    complexed with epe; mutant

Details for d2vjqc_

PDB Entry: 2vjq (more details), 1.8 Å

PDB Description: formyl-coa transferase mutant variant w48q
PDB Compounds: (C:) Formyl-coenzyme A transferase

SCOPe Domain Sequences for d2vjqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjqc_ c.123.1.1 (C:) automated matches {Oxalobacter formigenes [TaxId: 847]}
tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgqlqdkpnvdslyft
mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil
asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgdsnsgmhlmigil
aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn
plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew
kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps
lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike
lhakqvv

SCOPe Domain Coordinates for d2vjqc_:

Click to download the PDB-style file with coordinates for d2vjqc_.
(The format of our PDB-style files is described here.)

Timeline for d2vjqc_: