Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily) consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit |
Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (1 family) |
Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins) forms interlocked homodimer of two ring-like subunits |
Protein automated matches [190402] (3 species) not a true protein |
Species Oxalobacter formigenes [TaxId:847] [187276] (7 PDB entries) |
Domain d2vjqc_: 2vjq C: [168657] automated match to d1p5ha_ complexed with epe; mutant |
PDB Entry: 2vjq (more details), 1.8 Å
SCOPe Domain Sequences for d2vjqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vjqc_ c.123.1.1 (C:) automated matches {Oxalobacter formigenes [TaxId: 847]} tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgqlqdkpnvdslyft mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgdsnsgmhlmigil aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike lhakqvv
Timeline for d2vjqc_: