SCOPe 2.08: Domain d2vhla1: 2vhl A:3-57,A:359-394

Lineage for d2vhla1 (2vhl A:3-57,A:359-394)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)

6. Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [102019] (1 PDB entry)

8. Domain d2vhla1: 2vhl A:3-57,A:359-394 [168609]
   Other proteins in same PDB: d2vhla2, d2vhlb2
   complexed with fe, glp, pge

Details for d2vhla1

PDB Entry: 2vhl, 2.05 Å

PDB Description: the three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis

PDB Compounds: (A:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d2vhla1:

Sequence; same for both SEQRES and ATOM records:

>d2vhla1 b.92.1.5 (A:3-57,A:359-394) N-acetylglucosamine-6-phosphate deacetylase, NagA {Bacillus subtilis [TaxId: 1423]}
esllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpXsvtv
gkdadlvivssdcevilticrgniafiskead

Timeline for d2vhla1:

• d2vhla1 first appeared in SCOPe 2.01
  
• d2vhla1 appears in SCOPe 2.07